Vasoactive Intestinal Polypeptide Fragments

Overview

Vasoactive intestinal polypeptide (VIP) is a 28-amino acid member of the secretin/glucagon/PACAP superfamily with broad physiological actions on vasodilation, gastrointestinal secretion, bronchodilation, neurotransmission, and immunomodulation. Because the intact peptide binds its two principal GPCRs — VPAC1 and VPAC2 — with similar affinity and because these receptors mediate partially overlapping but tissue-specific effects, considerable effort has gone into synthesizing and characterizing fragments of VIP to dissect the structural basis of receptor recognition and to generate subtype-selective tools.

This encyclopedia entry surveys the main categories of VIP fragments studied in the literature: N-terminal fragments (which generally lose agonist activity but probe the "message" region), C-terminal fragments (which retain some binding but lose activation, acting as antagonists), internal fragments, and chimeric constructs combining VIP with related peptides PACAP, secretin, and growth hormone-releasing hormone.

The structure-function investigation of VIP using fragments exemplifies a general approach in peptide pharmacology: systematic truncation and substitution to identify the "message" (activation) and "address" (receptor-binding) domains, yielding insights that guide the design of full-length analogs with improved subtype selectivity, stability, and pharmacokinetics.

Structure/Sequence

Parent VIP: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ (28 aa, C-terminal amidation)

N-terminal Fragments

• VIP(1-12): HSDAVFTDNYTR — loses agonist activity at both VPAC1 and VPAC2; retains minimal binding
• VIP(1-17): HSDAVFTDNYTRLRKQM — partial agonist in some systems; useful for probing N-terminal contacts
• VIP(1-22): HSDAVFTDNYTRLRKQMAVKKY — weak partial agonist, demonstrates importance of C-terminal region

C-terminal Fragments (Antagonist-Prone)

• VIP(6-28): FTDNYTRLRKQMAVKKYLNSILN-NH₂ — weak partial agonist or antagonist depending on system
• VIP(10-28): YTRLRKQMAVKKYLNSILN-NH₂ — competitive VPAC1/2 antagonist
• [4Cl-D-Phe6, Leu17]-VIP: Modified hybrid acting as VPAC1 antagonist

Internal and Substituted Fragments

• VIP(1-28) variants with Ala-scan: Alanine-substitution at each position systematically identifies residues critical for receptor binding vs activation
• Pro-bridged analogs: Internal disulfide or proline-bridged structures to stabilize helical conformation

Chimeric Constructs

• PG97-269 ([K15,R16,L27]VIP(1-7)/GRF(8-27)): Chimera of VIP N-terminus with GRF C-terminus, VPAC1-selective agonist
• Ro 25-1553 / Ro 25-1392: Cyclic VIP analogs with VPAC2 selectivity used extensively as research tools
• BAY 55-9837: VPAC2-selective agonist derived from VIP/PACAP chimera

Mechanism of Action

Two-Domain Model

VIP-family peptides conform to a "two-domain" recognition model:

• N-terminal "message" region (residues 1-7): Essential for receptor activation; N-terminal His1 and Asp3 contact conserved receptor residues
• C-terminal "address" region (residues 15-28): Adopts α-helical conformation when bound to the extracellular domain of the receptor (ECD); determines binding affinity and subtype selectivity

N-terminal Fragment Behavior

• Minimal activation capacity — lack the C-terminal α-helix required for ECD anchoring
• Highlight the message region's role
• Subject of medicinal chemistry efforts to build minimal VIP agonists

C-terminal Fragment Antagonism

• Retain ECD binding through the C-terminal α-helix
• Lack the N-terminal message residues that activate the receptor
• Can competitively block intact VIP binding
• Prototype for VPAC antagonist design

Receptor Subtype Mapping

Systematic fragment studies revealed that residues critical for VPAC1 vs VPAC2 selectivity are distributed across both domains:

• Positions 11, 22, 26, 27 particularly important for subtype discrimination
• PACAP divergence: The difference between VIP and PACAP (68% identity over overlapping region) explains PACAP's higher affinity at PAC1 while retaining VPAC1/2 binding

PACAP-Chimeric Approaches

Because PACAP (38-aa or 27-aa forms) is closely related to VIP and binds PAC1 in addition to VPAC1/2, chimeras between VIP and PACAP have produced selective tools:

• PAC1-selective: Maxadilan and related approaches
• VPAC2-selective: BAY 55-9837 (VIP/PACAP hybrid)
• VPAC1-selective: PG97-269 (VIP/GRF hybrid)

Peptidase Vulnerability

VIP and its fragments are substrates for dipeptidyl peptidase IV (DPP-IV), which cleaves after position 2, destroying N-terminal activation capacity. DPP-IV–resistant fragment analogs (N-methylated, Aib-substituted) extend half-life.

Research Summary

Common Discussion Topics

1. Two-domain recognition — VIP fragments provide one of the clearest demonstrations of the "message/address" two-domain model. The N-terminal message region activates the receptor after the C-terminal address region has docked into the extracellular domain. This framework extends to the entire secretin/glucagon/PACAP superfamily.

2. Subtype selectivity through chimera — Fragment and chimera studies between VIP, PACAP, secretin, and GRF have generated a library of subtype-selective tools. These have been indispensable for dissecting physiological roles of VPAC1 vs VPAC2 vs PAC1 signaling in vivo.

3. Antagonist development — The observation that C-terminal fragments retain binding but lose activation provided the template for VIP antagonist design. This approach parallels antagonist development for other family B GPCRs (glucagon receptor, GLP-1 receptor).

4. Cyclization for stability — Because linear VIP is rapidly degraded, cyclic analogs (like Ro 25-1553) demonstrate the stabilization benefit of conformational constraint. This strategy generalizes across peptide pharmacology.

5. PACAP relationship — The close relationship between VIP and PACAP means that VIP fragments often have activity at PAC1 receptors as well, and pure VPAC1 or VPAC2 tools typically require the chimeric approach rather than simple truncations.

Related Compounds

• VIP — parent 28-aa peptide
• Secretin — related family member with distinct receptor